PDB entry 1dev

View 1dev on RCSB PDB site
Description: crystal structure of smad2 mh2 domain bound to the smad-binding domain of sara
Class: signaling protein
Keywords: beta sheet, three-helix bundle, signaling protein
Deposited on 1999-11-15, released 2000-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAD (mothers against decapentaplegic, Drosophila) homolog 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deva_
  • Chain 'B':
    Compound: Smad anchor for receptor activation
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1devb_
  • Chain 'C':
    Compound: MAD (mothers against decapentaplegic, Drosophila) homolog 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1devc_
  • Chain 'D':
    Compound: Smad anchor for receptor activation
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1devd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1devA (A:)
    ldlqpvtysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvn
    rnatvemtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgc
    nlkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwiel
    hlngplqwldkvltqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1devA (A:)
    lqpvtysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrn
    atvemtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnl
    kifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhl
    ngplqwldkvltqm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1devB (B:)
    sqspnpnnpaeycstipplqqaqasgalssppptvmvpvgv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1devC (C:)
    ldlqpvtysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvn
    rnatvemtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgc
    nlkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwiel
    hlngplqwldkvltqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1devC (C:)
    ldlqpvtysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvn
    rnatvemtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgc
    nlkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgrqtvtstpcwielhlng
    plqwldkvltqm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1devD (D:)
    sqspnpnnpaeycstipplqqaqasgalssppptvmvpvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1devD (D:)
    sqspnpnnpaeycstipplqqaqasgalssppptvmvpv