Lineage for d1devb_ (1dev B:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046929Fold j.64: Smad-binding domain of Sara [58717] (1 superfamily)
  4. 3046930Superfamily j.64.1: Smad-binding domain of Sara [58718] (1 family) (S)
  5. 3046931Family j.64.1.1: Smad-binding domain of Sara [58719] (1 protein)
  6. 3046932Protein Smad-binding domain of Sara [58720] (1 species)
  7. 3046933Species Human (Homo sapiens) [TaxId:9606] [58721] (2 PDB entries)
  8. 3046934Domain d1devb_: 1dev B: [46354]
    Other proteins in same PDB: d1deva_, d1devc_
    bound to the Smad2 MH2 domain

Details for d1devb_

PDB Entry: 1dev (more details), 2.2 Å

PDB Description: crystal structure of smad2 mh2 domain bound to the smad-binding domain of sara
PDB Compounds: (B:) Smad anchor for receptor activation

SCOPe Domain Sequences for d1devb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1devb_ j.64.1.1 (B:) Smad-binding domain of Sara {Human (Homo sapiens) [TaxId: 9606]}
sqspnpnnpaeycstipplqqaqasgalssppptvmvpvgv

SCOPe Domain Coordinates for d1devb_:

Click to download the PDB-style file with coordinates for d1devb_.
(The format of our PDB-style files is described here.)

Timeline for d1devb_: