PDB entry 1dec

View 1dec on RCSB PDB site
Description: structure of the rgd protein decorsin: conserved motif and distinct function in leech proteins that affect blood clotting
Deposited on 1994-05-17, released 1994-08-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1dec__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dec_ (-)
    aprlpqcqgddqekclcnkdecppgqcrfprgdadpyce