PDB entry 1dec

View 1dec on RCSB PDB site
Description: structure of the rgd protein decorsin: conserved motif and distinct function in leech proteins that affect blood clotting
Class: blood coagulation
Keywords: blood coagulation
Deposited on 1994-05-17, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: decorsin
  Species: Macrobdella decora [TaxId:6405]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17350 (0-38)
  Domains in SCOPe 2.08: d1deca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1decA (A:)
  aprlpqcqgddqekclcnkdecppgqcrfprgdadpyce