Lineage for d1deca_ (1dec A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2583429Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) (S)
  5. 2583451Family g.3.15.2: Hirudin-like [57270] (4 proteins)
  6. 2583452Protein Decorsin [57273] (1 species)
  7. 2583453Species North american leech (Macrobdella decora) [TaxId:6405] [57274] (1 PDB entry)
  8. 2583454Domain d1deca_: 1dec A: [44376]

Details for d1deca_

PDB Entry: 1dec (more details)

PDB Description: structure of the rgd protein decorsin: conserved motif and distinct function in leech proteins that affect blood clotting
PDB Compounds: (A:) decorsin

SCOPe Domain Sequences for d1deca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deca_ g.3.15.2 (A:) Decorsin {North american leech (Macrobdella decora) [TaxId: 6405]}
aprlpqcqgddqekclcnkdecppgqcrfprgdadpyce

SCOPe Domain Coordinates for d1deca_:

Click to download the PDB-style file with coordinates for d1deca_.
(The format of our PDB-style files is described here.)

Timeline for d1deca_: