PDB entry 1dd3

View 1dd3 on RCSB PDB site
Description: crystal structure of ribosomal protein l12 from thermotoga maritima
Class: ribosome
Keywords: dimer formation, flexibility, hinge region, four-helix-bundle, five-helix- bundle, alpha-beta structure, helical hairpin, domains, ribosome
Deposited on 1999-11-08, released 2000-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 50S ribosomal protein L7/L12
  Species: Thermotoga maritima [TaxId:2336]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29396 (0-127)
  Domains in SCOPe 2.08: d1dd3a1, d1dd3a2
• Chain 'B':
  Compound: 50S ribosomal protein L7/L12
  Species: Thermotoga maritima [TaxId:2336]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29396 (0-127)
  Domains in SCOPe 2.08: d1dd3b1, d1dd3b2
• Chain 'C':
  Compound: 50S ribosomal protein L7/L12
  Species: Thermotoga maritima [TaxId:2336]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29396 (0-31)
  Domains in SCOPe 2.08: d1dd3c_
• Chain 'D':
  Compound: 50S ribosomal protein L7/L12
  Species: Thermotoga maritima [TaxId:2336]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29396 (0-31)
  Domains in SCOPe 2.08: d1dd3d_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dd3A (A:)
  mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefd
  vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkklee
  agaevelk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dd3B (B:)
  mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefd
  vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkklee
  agaevelk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dd3C (C:)
  mtideiieaiekltvselaelvkkledkfgvt
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dd3D (D:)
  mtideiieaiekltvselaelvkkledkfgvt