PDB entry 1dd3

View 1dd3 on RCSB PDB site
Description: crystal structure of ribosomal protein l12 from thermotoga maritima
Class: ribosome
Keywords: dimer formation, flexibility, hinge region, four-helix-bundle, five-helix- bundle, alpha-beta structure, helical hairpin, domains, ribosome
Deposited on 1999-11-08, released 2000-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd3a1, d1dd3a2
  • Chain 'B':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd3b1, d1dd3b2
  • Chain 'C':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd3c_
  • Chain 'D':
    Compound: 50S ribosomal protein L7/L12
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd3d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd3A (A:)
    mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefd
    vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkklee
    agaevelk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd3B (B:)
    mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefd
    vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkklee
    agaevelk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd3C (C:)
    mtideiieaiekltvselaelvkkledkfgvt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd3D (D:)
    mtideiieaiekltvselaelvkkledkfgvt