SCOPe 2.08: Domain d1dd3b2: 1dd3 B:58-128

Lineage for d1dd3b2 (1dd3 B:58-128)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)
   automatically mapped to Pfam PF00542

6. Protein Ribosomal protein L7/12, C-terminal domain [54738] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [54740] (3 PDB entries)

8. Domain d1dd3b2: 1dd3 B:58-128 [38761]
   Other proteins in same PDB: d1dd3a1, d1dd3b1, d1dd3c_, d1dd3d_

Details for d1dd3b2

PDB Entry: 1dd3, 2 Å

PDB Description: crystal structure of ribosomal protein l12 from thermotoga maritima

PDB Compounds: (B:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1dd3b2:

Sequence; same for both SEQRES and ATOM records:

>d1dd3b2 d.45.1.1 (B:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk

Timeline for d1dd3b2:

• d1dd3b2 first appeared (with stable ids) in SCOP 1.55
  
• d1dd3b2 appears in SCOPe 2.07