PDB entry 1dcz

View 1dcz on RCSB PDB site
Description: biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)
Class: transferase
Keywords: antiparallel beta sheet, hammerhead, biocytin, transferase
Deposited on 1999-11-05, released 2000-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcarboxylase 1.3s subunit
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dcza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dczA (A:)
    agagkagegeipaplagtvskilvkegdtvkagqtvlvleamkmeteinaptdgkvekvl
    vkerdavqggqglikig