PDB entry 1dby

View 1dby on RCSB PDB site
Description: nmr structures of chloroplast thioredoxin m ch2 from the green alga chlamydomonas reinhardtii
Class: oxidoreductase
Keywords: thioredoxin m, thioredoxin ch2, chloroplastic thioredoxin, oxidoreductase
Deposited on 1999-11-03, released 1999-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chloroplast thioredoxin m ch2
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: NUCLEAR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23400 (0-106)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1dbya1, d1dbya2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dbyA (A:)
  meagavnddtfknvvlessvpvlvdfwapwcgpcriiapvvdeiageykdklkcvklntd
  espnvaseygirsiptimvfkggkkcetiigavpkativqtvekyln