Lineage for d1dbya1 (1dby A:2-107)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876337Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [52838] (4 PDB entries)
  8. 2876343Domain d1dbya1: 1dby A:2-107 [32734]
    Other proteins in same PDB: d1dbya2

Details for d1dbya1

PDB Entry: 1dby (more details)

PDB Description: nmr structures of chloroplast thioredoxin m ch2 from the green alga chlamydomonas reinhardtii
PDB Compounds: (A:) chloroplast thioredoxin m ch2

SCOPe Domain Sequences for d1dbya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbya1 c.47.1.1 (A:2-107) Thioredoxin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
eagavnddtfknvvlessvpvlvdfwapwcgpcriiapvvdeiageykdklkcvklntde
spnvaseygirsiptimvfkggkkcetiigavpkativqtvekyln

SCOPe Domain Coordinates for d1dbya1:

Click to download the PDB-style file with coordinates for d1dbya1.
(The format of our PDB-style files is described here.)

Timeline for d1dbya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbya2