| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Thioredoxin [52835] (16 species) |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [52838] (4 PDB entries) |
| Domain d1dbya1: 1dby A:2-107 [32734] Other proteins in same PDB: d1dbya2 |
PDB Entry: 1dby (more details)
SCOPe Domain Sequences for d1dbya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dbya1 c.47.1.1 (A:2-107) Thioredoxin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
eagavnddtfknvvlessvpvlvdfwapwcgpcriiapvvdeiageykdklkcvklntde
spnvaseygirsiptimvfkggkkcetiigavpkativqtvekyln
Timeline for d1dbya1: