PDB entry 1d8t

View 1d8t on RCSB PDB site
Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic
Class: hydrolase/antibiotic
Keywords: hydrolase-antibiotic complex, thiopeptide, antibiotic, antibacterial, thiazole, oxazole, hydrolase, gtpase, translation elongation factor, protein synthesis, nucleotide-binding, phosphorylation
Deposited on 1999-10-25, released 2000-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6N1 (Start-392)
      • conflict (392)
    Domains in SCOPe 2.07: d1d8ta1, d1d8ta2, d1d8ta3
  • Chain 'B':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6N1 (Start-392)
      • conflict (392)
    Domains in SCOPe 2.07: d1d8tb1, d1d8tb2, d1d8tb3
  • Chain 'C':
    Compound: thiocillin ge2270
    Species: PLANOBISPORA ROSEA [TaxId:35762]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: thiocillin ge2270
    Species: PLANOBISPORA ROSEA [TaxId:35762]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GDP, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d8tA (A:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8tA (A:)
    ekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargiti
    ntshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillg
    rqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegda
    eweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeev
    eivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikpht
    kfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtl
    ihpiamddglrfaireggrtvgagvvakvlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d8tB (B:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8tB (B:)
    kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvlg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.