Lineage for d1d8tb1 (1d8t B:205-296)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2385975Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2386038Family b.43.3.1: Elongation factors [50448] (11 protein domains)
  6. 2386122Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 2386129Species Escherichia coli [TaxId:562] [50450] (8 PDB entries)
    Uniprot P02990
  8. 2386139Domain d1d8tb1: 1d8t B:205-296 [25687]
    Other proteins in same PDB: d1d8ta2, d1d8ta3, d1d8tb2, d1d8tb3
    complexed with act, gdp, mg

Details for d1d8tb1

PDB Entry: 1d8t (more details), 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d1d8tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8tb1 b.43.3.1 (B:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d1d8tb1:

Click to download the PDB-style file with coordinates for d1d8tb1.
(The format of our PDB-style files is described here.)

Timeline for d1d8tb1: