PDB entry 1d4k

View 1d4k on RCSB PDB site
Description: hiv-1 protease complexed with a macrocyclic peptidomimetic inhibitor
Deposited on 1999-10-04, released 2000-10-11
The last revision prior to the SCOP 1.63 freeze date was dated 2000-10-11, with a file datestamp of 2000-10-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1d4ka_
  • Chain 'B':
    Domains in SCOP 1.63: d1d4kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4kA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4kB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf