PDB entry 1d2a

View 1d2a on RCSB PDB site
Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the activator adenine
Class: hydrolase
Keywords: beta-alpha-beta, tyrosine phosphatase, ltp1, hydrolase
Deposited on 1999-09-22, released 2000-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40347 (Start-159)
      • engineered (12)
    Domains in SCOPe 2.07: d1d2aa_
  • Chain 'B':
    Compound: tyrosine phosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40347 (Start-159)
      • engineered (12)
    Domains in SCOPe 2.07: d1d2ab_
  • Heterogens: PO4, CL, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d2aA (A:)
    tiekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhr
    tvsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwn
    tndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2aA (A:)
    pkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
    ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
    tvqtiiedpwygdiqdfeynfkqityfskqflkkel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d2aB (B:)
    tiekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhr
    tvsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwn
    tndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2aB (B:)
    pkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
    ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
    tvqtiiedpwygdiqdfeynfkqityfskqflkkel