![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) ![]() share the common active site structure with the family II |
![]() | Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins) automatically mapped to Pfam PF01451 |
![]() | Protein Tyrosine phosphatase [52790] (5 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries) |
![]() | Domain d1d2ab_: 1d2a B: [32645] complexed with ade, cl, po4 |
PDB Entry: 1d2a (more details), 1.9 Å
SCOPe Domain Sequences for d1d2ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2ab_ c.44.1.1 (B:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg tvqtiiedpwygdiqdfeynfkqityfskqflkkel
Timeline for d1d2ab_: