PDB entry 1cz5

View 1cz5 on RCSB PDB site
Description: nmr structure of vat-n: the n-terminal domain of vat (vcp-like ATPase of thermoplasma)
Class: hydrolase
Keywords: double-psi beta-barrel, beta-clam, substrate recognition domain, fusion protein, hydrolase
Deposited on 1999-09-01, released 1999-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vcp-like ATPase
  Species: Thermoplasma acidophilum [TaxId:2303]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O05209 (0-182)
    • see remark 999 (183-184)
  Domains in SCOPe 2.06: d1cz5a1, d1cz5a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cz5A (A:)
  mesnngiilrvaeanstdpgmsrvrldessrrlldaeigdvveiekvrktvgrvyrarpe
  denkgivridsvmrnncgasigdkvkvrkvrteiakkvtlapiirkdqrlkfgegieeyv
  qralirrpmleqdnisvpgltlagqtgllfkvvktlpskvpveigeetkieireepasev
  leegg