PDB entry 1cz2

View 1cz2 on RCSB PDB site
Description: solution structure of wheat ns-ltp complexed with prostaglandin b2.
Class: lipid binding protein
Keywords: protein complex alpha helix, lipid binding protein
Deposited on 1999-09-01, released 2000-09-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nonspecific lipid transfer protein
  Species: Triticum aestivum [TaxId:4565]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24296 (0-89)
  Domains in SCOPe 2.06: d1cz2a_
• Heterogens: E2P

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cz2A (A:)
  idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
  lnednarsippkcgvnlpytislnidcsrv