PDB entry 1cyq

View 1cyq on RCSB PDB site
Description: intron encoded homing endonuclease I-ppoi (h98a)/DNA homing site complex
Class: hydrolase/DNA
Keywords: protein-DNA complex, distorted DNA, his-cys box zinc binding site, beta sheet DNA binding, hydrolase/DNA complex
Deposited on 1999-08-31, released 1999-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intron-encoded homing endonuclease I-ppoi
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94702
      • engineered (96)
    Domains in SCOPe 2.07: d1cyqa_
  • Chain 'B':
    Compound: intron-encoded homing endonuclease I-ppoi
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94702 (0-161)
      • engineered (96)
    Domains in SCOPe 2.07: d1cyqb_
  • Chain 'C':
    Compound: 5'-d(*tp*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*ap*gp*ap*gp*ap*gp*tp*cp*a)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-d(*tp*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*ap*gp*ap*gp*ap*gp*tp*cp*a)-3'
    Species: synthetic, synthetic
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cyqA (A:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctasalchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cyqB (B:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctasalchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.