PDB entry 1cyq

View 1cyq on RCSB PDB site
Description: intron encoded homing endonuclease I-ppoi (h98a)/DNA homing site complex
Class: hydrolase/DNA
Keywords: protein-DNA complex, distorted DNA, his-cys box zinc binding site, beta sheet DNA binding, hydrolase/DNA complex
Deposited on 1999-08-31, released 1999-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: intron-encoded homing endonuclease I-ppoi
  Species: Physarum polycephalum [TaxId:5791]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94702
    • engineered (96)
  Domains in SCOPe 2.08: d1cyqa_
• Chain 'B':
  Compound: intron-encoded homing endonuclease I-ppoi
  Species: Physarum polycephalum [TaxId:5791]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94702 (0-161)
    • engineered (96)
  Domains in SCOPe 2.08: d1cyqb_
• Chain 'C':
  Compound: 5'-d(*tp*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*ap*gp*ap*gp*ap*gp*tp*cp*a)-3'
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: 5'-d(*tp*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*ap*gp*ap*gp*ap*gp*tp*cp*a)-3'
  Species: synthetic, synthetic
  
• Heterogens: ZN, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cyqA (A:)
  altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
  wqykrtinqvvhrwgshtvpfllepdningktctasalchntrchnplhlcweslddnkg
  rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cyqB (B:)
  altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
  wqykrtinqvvhrwgshtvpfllepdningktctasalchntrchnplhlcweslddnkg
  rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.