PDB entry 1cyo

View 1cyo on RCSB PDB site
Description: bovine cytochrome b(5)
Deposited on 1994-08-03, released 1994-11-30
The last revision prior to the SCOP 1.59 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.16
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1cyo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cyo_ (-)
    skavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktfiigelhpddrskit