PDB entry 1cxw

View 1cxw on RCSB PDB site
Description: the second type ii module from human matrix metalloproteinase 2
Deposited on 1999-08-31, released 1999-11-12
The last revision prior to the SCOP 1.61 freeze date was dated 1999-11-12, with a file datestamp of 1999-11-11.
Experiment type: NMR50
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1cxwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxwA (A:)
    talftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpeta