PDB entry 1cxk

View 1cxk on RCSB PDB site
Description: complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n
Class: transferase
Keywords: glycosyl hydrolase family 13, alpha-amylase family, substrate complex, maltononaose, transferase
Deposited on 1999-02-24, released 1999-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cyclodextrin-glycosyltransferase)
    Species: Bacillus circulans, synthetic [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43379 (0-685)
      • engineered (256)
      • engineered (228)
    Domains in SCOPe 2.07: d1cxka1, d1cxka2, d1cxka3, d1cxka4
  • Heterogens: GLC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cxkA (A:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
    indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
    liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
    tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmnavkhmpfgwqk
    sfmaavnnykpvftfgqwflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
    yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
    gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiaygstqerwinndvli
    yerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllngntlsvgsggaasnf
    tlaaggtavwqytaatatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgad
    itswedtqikvkipavaggnynikvanaagtasnvydnfevlsgdqvsvrfvvnnattal
    gqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvpagktiefkflkkqgstv
    tweggsnhtftapssgtatinvnwqp