Lineage for d1cxka2 (1cxk A:584-686)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768632Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2768633Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 2768647Domain d1cxka2: 1cxk A:584-686 [22504]
    Other proteins in same PDB: d1cxka1, d1cxka3, d1cxka4
    complexed with ca

Details for d1cxka2

PDB Entry: 1cxk (more details), 2.09 Å

PDB Description: complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n
PDB Compounds: (A:) protein (cyclodextrin-glycosyltransferase)

SCOPe Domain Sequences for d1cxka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxka2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp
agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOPe Domain Coordinates for d1cxka2:

Click to download the PDB-style file with coordinates for d1cxka2.
(The format of our PDB-style files is described here.)

Timeline for d1cxka2: