PDB entry 1cwu

View 1cwu on RCSB PDB site
Description: brassica napus enoyl acp reductase a138g mutant complexed with nad+ and thienodiazaborine
Class: oxidoreductase
Keywords: oxidoreductase, plant lipid biosynthesis, diazaborine
Deposited on 1999-08-26, released 1999-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl acp reductase
    Species: Brassica napus [TaxId:3708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80030 (0-295)
      • engineered (29)
    Domains in SCOPe 2.07: d1cwua_
  • Chain 'B':
    Compound: enoyl acp reductase
    Species: Brassica napus [TaxId:3708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80030 (0-295)
      • engineered (29)
    Domains in SCOPe 2.07: d1cwub_
  • Heterogens: NAD, TDB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwuA (A:)
    lpidlrgkrafiagiaddngygwavakslaaagaeilvgtwvpalnifetslrrgkfdqs
    rvlpdgslmeikkvypldavfdnpedvpedvkankryagssnwtvqeaaecvrqdfgsid
    ilvhslgngpevskplletsrkgylaaisassysfvsllshflpimnpggasisltyias
    eriipgygggmssakaalesdtrvlafeagrkqnirvntisagplgsraakaigfidtmi
    eysynnapiqktltadevgnaaaflvsplasaitgatiyvdnglnsmgvaldspvf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwuB (B:)
    lpidlrgkrafiagiaddngygwavakslaaagaeilvgtwvpalnifetslrrgkfdqs
    rvlpdgslmeikkvypldavfdnpedvpedvkankryagssnwtvqeaaecvrqdfgsid
    ilvhslgngpevskplletsrkgylaaisassysfvsllshflpimnpggasisltyias
    eriipgygggmssakaalesdtrvlafeagrkqnirvntisagplgsraakaigfidtmi
    eysynnapiqktltadevgnaaaflvsplasaitgatiyvdnglnsmgvaldspvf