SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1cwub_ (1cwu B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091104Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2091367Species Oil seed rape (Brassica napus) [TaxId:3708] [51792] (4 PDB entries)
  8. 2091372Domain d1cwub_: 1cwu B: [29909]
    complexed with nad, tdb; mutant

Details for d1cwub_

PDB Entry: 1cwu (more details), 2.5 Å

PDB Description: brassica napus enoyl acp reductase a138g mutant complexed with nad+ and thienodiazaborine
PDB Compounds: (B:) enoyl acp reductase

SCOPe Domain Sequences for d1cwub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwub_ c.2.1.2 (B:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}
lpidlrgkrafiagiaddngygwavakslaaagaeilvgtwvpalnifetslrrgkfdqs
rvlpdgslmeikkvypldavfdnpedvpedvkankryagssnwtvqeaaecvrqdfgsid
ilvhslgngpevskplletsrkgylaaisassysfvsllshflpimnpggasisltyias
eriipgygggmssakaalesdtrvlafeagrkqnirvntisagplgsraakaigfidtmi
eysynnapiqktltadevgnaaaflvsplasaitgatiyvdnglnsmgvaldspvf

SCOPe Domain Coordinates for d1cwub_:

Click to download the PDB-style file with coordinates for d1cwub_.
(The format of our PDB-style files is described here.)

Timeline for d1cwub_: