PDB entry 1cwf

View 1cwf on RCSB PDB site
Description: human cyclophilin a complexed with 2-val cyclosporin
Deposited on 1998-04-30, released 1998-07-15
The last revision prior to the SCOP 1.59 freeze date was dated 1998-07-15, with a file datestamp of 1998-07-15.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1cwfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwfA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle