PDB entry 1cw4

View 1cw4 on RCSB PDB site
Description: crystal structure of k230m isocitrate dehydrogenase in complex with alpha-ketoglutarate
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Isocitrate Dehydrogenase, mutant
Deposited on 1999-08-25, released 1999-09-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08200 (Start-415)
      • conflict (229)
    Domains in SCOPe 2.06: d1cw4a_
  • Heterogens: MN, SO4, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cw4A (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhmgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cw4A (A:)
    eskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykger
    kiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqe
    ldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflre
    emgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhmgnimkftegaf
    kdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviac
    mnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsae
    mmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm