PDB entry 1cw0

View 1cw0 on RCSB PDB site
Description: crystal structure analysis of very short patch repair (vsr) endonuclease in complex with a duplex DNA
Class: hydrolase/DNA
Keywords: protein-DNA complex, mismatch, intercalation, zinc, hydrolase/DNA
Deposited on 1999-08-25, released 1999-12-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA mismatch endonuclease)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1cw0a_
  • Chain 'M':
    Compound: DNA (5'-d(*ap*cp*gp*tp*ap*cp*cp*tp*gp*gp*cp*t)-3')
  • Chain 'N':
    Compound: DNA (5'-d(*ap*gp*c)-3')
  • Chain 'O':
    Compound: DNA (5'-d(p*tp*ap*gp*gp*tp*ap*cp*gp*t)-3')
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cw0A (A:)
    advhdkatrsknmraiatrdtaiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvi
    fthgcfwhhhhcylfkvpatrtefwlekigknverdrrdisrlqelgwrvlivwecalrg
    rekltdealterleewicgegasaqidtqgihlla
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.