PDB entry 1ct1

View 1ct1 on RCSB PDB site
Description: cholera toxin b-pentamer mutant g33r bound to receptor pentasaccharide
Class: enterotoxin
Keywords: enterotoxin, toxin/receptor complex, oligosaccharide
Deposited on 1997-06-03, released 1997-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.04: d1ct1d_
  • Chain 'E':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.04: d1ct1e_
  • Chain 'F':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.04: d1ct1f_
  • Chain 'G':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.04: d1ct1g_
  • Chain 'H':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • engineered (32)
      • conflict (46)
    Domains in SCOPe 2.04: d1ct1h_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1D (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1E (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1F (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1G (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1H (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman