PDB entry 1cry

View 1cry on RCSB PDB site
Description: application of an automatic molecular replacement procedure to crystal structure of cytochrome c2 from rhodopseudomonas viridis
Deposited on 1993-12-27, released 1994-04-30
The last revision prior to the SCOP 1.61 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1cry__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cry_ (-)
    qdaasgeqvfkqclvchsigpgaknkvgpvlnglfgrhsgtiegfaysdanknsgitwte
    evfreyirdpkakipgtkmifagvkdeqkvsdliayikqfnadgskk