PDB entry 1crk

View 1crk on RCSB PDB site
Description: mitochondrial creatine kinase
Class: transferase
Keywords: transferase, creatine kinase
Deposited on 1996-03-08, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creatine kinase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crka1, d1crka2
  • Chain 'B':
    Compound: creatine kinase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crkb1, d1crkb2
  • Chain 'C':
    Compound: creatine kinase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crkc1, d1crkc2
  • Chain 'D':
    Compound: creatine kinase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crkd1, d1crkd2
  • Heterogens: PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crkA (A:)
    tvhekrklfppsadypdlrkhnncmaecltpaiyaklrdkltpngysldqciqtgvdnpg
    hpfiktvgmvagdeesyevfaeifdpvikarhngydprtmkhhtdldaskithgqfdery
    vlssrvrtgrsirglslppacsraerrevenvvvtalaglkgdlsgkyysltnmserdqq
    qliddhflfdkpvsplltcagmardwpdargiwhnndktflvwineedhtrvismekggn
    mkrvferfcrglkeverlikergwefmwnerlgyvltcpsnlgtglragvhvklprlskd
    prfpkilenlrlqkrgtggvdtaavadvydisnldrmgrsevelvqividgvnylvdcek
    klekgqdikvppplpqfgrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crkB (B:)
    tvhekrklfppsadypdlrkhnncmaecltpaiyaklrdkltpngysldqciqtgvdnpg
    hpfiktvgmvagdeesyevfaeifdpvikarhngydprtmkhhtdldaskithgqfdery
    vlssrvrtgrsirglslppacsraerrevenvvvtalaglkgdlsgkyysltnmserdqq
    qliddhflfdkpvsplltcagmardwpdargiwhnndktflvwineedhtrvismekggn
    mkrvferfcrglkeverlikergwefmwnerlgyvltcpsnlgtglragvhvklprlskd
    prfpkilenlrlqkrgtggvdtaavadvydisnldrmgrsevelvqividgvnylvdcek
    klekgqdikvppplpqfgrk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crkC (C:)
    tvhekrklfppsadypdlrkhnncmaecltpaiyaklrdkltpngysldqciqtgvdnpg
    hpfiktvgmvagdeesyevfaeifdpvikarhngydprtmkhhtdldaskithgqfdery
    vlssrvrtgrsirglslppacsraerrevenvvvtalaglkgdlsgkyysltnmserdqq
    qliddhflfdkpvsplltcagmardwpdargiwhnndktflvwineedhtrvismekggn
    mkrvferfcrglkeverlikergwefmwnerlgyvltcpsnlgtglragvhvklprlskd
    prfpkilenlrlqkrgtggvdtaavadvydisnldrmgrsevelvqividgvnylvdcek
    klekgqdikvppplpqfgrk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crkD (D:)
    tvhekrklfppsadypdlrkhnncmaecltpaiyaklrdkltpngysldqciqtgvdnpg
    hpfiktvgmvagdeesyevfaeifdpvikarhngydprtmkhhtdldaskithgqfdery
    vlssrvrtgrsirglslppacsraerrevenvvvtalaglkgdlsgkyysltnmserdqq
    qliddhflfdkpvsplltcagmardwpdargiwhnndktflvwineedhtrvismekggn
    mkrvferfcrglkeverlikergwefmwnerlgyvltcpsnlgtglragvhvklprlskd
    prfpkilenlrlqkrgtggvdtaavadvydisnldrmgrsevelvqividgvnylvdcek
    klekgqdikvppplpqfgrk