Lineage for d1crkb2 (1crk B:99-380)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974891Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2974919Protein Creatine kinase, C-terminal domain [55936] (7 species)
  7. 2974925Species Chicken (Gallus gallus), mitochondria [TaxId:9031] [55937] (1 PDB entry)
  8. 2974927Domain d1crkb2: 1crk B:99-380 [41194]
    Other proteins in same PDB: d1crka1, d1crkb1, d1crkc1, d1crkd1
    complexed with po4

Details for d1crkb2

PDB Entry: 1crk (more details), 3 Å

PDB Description: mitochondrial creatine kinase
PDB Compounds: (B:) creatine kinase

SCOPe Domain Sequences for d1crkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crkb2 d.128.1.2 (B:99-380) Creatine kinase, C-terminal domain {Chicken (Gallus gallus), mitochondria [TaxId: 9031]}
tmkhhtdldaskithgqfderyvlssrvrtgrsirglslppacsraerrevenvvvtala
glkgdlsgkyysltnmserdqqqliddhflfdkpvsplltcagmardwpdargiwhnndk
tflvwineedhtrvismekggnmkrvferfcrglkeverlikergwefmwnerlgyvltc
psnlgtglragvhvklprlskdprfpkilenlrlqkrgtggvdtaavadvydisnldrmg
rsevelvqividgvnylvdcekklekgqdikvppplpqfgrk

SCOPe Domain Coordinates for d1crkb2:

Click to download the PDB-style file with coordinates for d1crkb2.
(The format of our PDB-style files is described here.)

Timeline for d1crkb2: