PDB entry 1cre

View 1cre on RCSB PDB site
Description: cardiotoxin ii from taiwan cobra venom, naja naja atra: structure in solution and comparision among homologous cardiotoxins
Deposited on 1994-03-12, released 1994-05-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1cre__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cre_ (-)
    lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn