PDB entry 1cr8

View 1cr8 on RCSB PDB site
Description: low density lipoprotein receptor-related protein complement repeat 8
Class: lipid binding protein
Keywords: receptor, ligand binding, calcium binding, ldlr, lrp, lipid binding protein
Deposited on 1998-12-14, released 1998-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (low density lipoprotein receptor related protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cr8a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cr8A (A:)
    pggchtdefqcrldglciplrwrcdgdtdcmdssdekscegv