Lineage for d1cr8a_ (1cr8 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584510Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 2584511Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 2584512Family g.12.1.1: LDL receptor-like module [57425] (7 proteins)
  6. 2584522Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 2584523Species Human (Homo sapiens) [TaxId:9606] [57427] (13 PDB entries)
    Uniprot P01130 272-353
  8. 2584534Domain d1cr8a_: 1cr8 A: [44613]
    complement module 8
    complexed with ca

Details for d1cr8a_

PDB Entry: 1cr8 (more details)

PDB Description: low density lipoprotein receptor-related protein complement repeat 8
PDB Compounds: (A:) protein (low density lipoprotein receptor related protein)

SCOPe Domain Sequences for d1cr8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
pggchtdefqcrldglciplrwrcdgdtdcmdssdekscegv

SCOPe Domain Coordinates for d1cr8a_:

Click to download the PDB-style file with coordinates for d1cr8a_.
(The format of our PDB-style files is described here.)

Timeline for d1cr8a_: