PDB entry 1cqy

View 1cqy on RCSB PDB site
Description: starch binding domain of bacillus cereus beta-amylase
Class: hydrolase
Keywords: starch-binding domain, b-amylase, 3d structure, hydrolase
Deposited on 1999-08-12, released 1999-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-amylase
  Species: Bacillus cereus [TaxId:1396]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Z4N9 (0-98)
  Domains in SCOPe 2.08: d1cqya_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cqyA (A:)
  tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
  niefkafikskdgtvkswqtiqqswnpvplkttshtssw