PDB entry 1cqy

View 1cqy on RCSB PDB site
Description: starch binding domain of bacillus cereus beta-amylase
Class: hydrolase
Keywords: starch-binding domain, b-amylase, 3d structure, hydrolase
Deposited on 1999-08-12, released 1999-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cqya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqyA (A:)
    tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
    niefkafikskdgtvkswqtiqqswnpvplkttshtssw