Lineage for d1cqya_ (1cqy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768600Protein beta-amylase [49462] (1 species)
  7. 2768601Species Bacillus cereus [TaxId:1396] [49463] (12 PDB entries)
  8. 2768631Domain d1cqya_: 1cqy A: [22527]

Details for d1cqya_

PDB Entry: 1cqy (more details), 1.95 Å

PDB Description: starch binding domain of bacillus cereus beta-amylase
PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1cqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqya_ b.3.1.1 (A:) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOPe Domain Coordinates for d1cqya_:

Click to download the PDB-style file with coordinates for d1cqya_.
(The format of our PDB-style files is described here.)

Timeline for d1cqya_: