| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
| Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
| Protein beta-amylase [49462] (1 species) |
| Species Bacillus cereus [TaxId:1396] [49463] (12 PDB entries) |
| Domain d1cqya_: 1cqy A: [22527] |
PDB Entry: 1cqy (more details), 1.95 Å
SCOPe Domain Sequences for d1cqya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqya_ b.3.1.1 (A:) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw
Timeline for d1cqya_: