PDB entry 1cpn

View 1cpn on RCSB PDB site
Description: native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis
Deposited on 1994-03-11, released 1994-06-22
The last revision prior to the SCOP 1.59 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: -1.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1cpn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpn_ (-)
    fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
    qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
    immnlwngtgvddwlgsynganplyaeydwvkytsngsvfwepksyfnpstwekadgysn
    ggvfnctwrannvnftndgklklgltss