PDB entry 1cpi

View 1cpi on RCSB PDB site
Description: regioselective structural and functional mimicry of peptides. design of hydrolytically stable cyclic peptidomimetic inhibitors of hiv-1 protease
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1995-10-16, released 1996-03-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.163
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.04: d1cpia_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.04: d1cpib_
  • Chain 'C':
    Compound: cyclic peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1CPI (0-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpiA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cpiB (B:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'C':
    No sequence available.