PDB entry 1cp9

View 1cp9 on RCSB PDB site
Description: crystal structure of penicillin g acylase from the bro1 mutant strain of providencia rettgeri
Class: hydrolase
Keywords: antibiotic resistance, amidohydrolase, ntn-hydrolase fold, n-terminal pyroglutamate, penicillin binding protein, calcium binding protein, hydrolase
Deposited on 1999-06-12, released 1999-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin G amidase
    Species: Providencia rettgeri [TaxId:587]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WZI9 (0-End)
      • engineered mutation (139)
    Domains in SCOPe 2.07: d1cp9.1
  • Chain 'B':
    Compound: Penicillin G amidase
    Species: Providencia rettgeri [TaxId:587]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cp9.1
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cp9A (A:)
    estqikierdnygvphiyandtyslfygygyavaqdrlfqmemakrstqgtvsevfgkdy
    isfdkeirnnywpdsihkqinqlpsqeqdilrgyadgmnawikqintkpddlmpkqfidy
    dflpsqwtsfdvamimvgtlanrfsdmnseidnlalltalkdkygeqlgveffnqinwln
    npnapttisseeftysdsqktknis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cp9A (A:)
    estqikierdnygvphiyandtyslfygygyavaqdrlfqmemakrstqgtvsevfgkdy
    isfdkeirnnywpdsihkqinqlpsqeqdilrgyadgmnawikqintkpddlmpkqfidy
    dflpsqwtsfdvamimvgtlanrfsdmnseidnlalltalkdkygeqlgveffnqinwln
    npnapttisseeftysd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cp9B (B:)
    snvwlvgktkasgakaillngpqfgwfnpaytygiglhgagfnivgntpfaypailfghn
    ghvswgstagfgdgvdifaeqvspedpnsylhqgqwkkmlsrqetlnvkgeqpitfeiyr
    tvhgnvvkrdktthtayskarawdgkeltslmawvkqgqaqnwqqwldqaqnqaltinwy
    yadkdgnigyvhtghypdrqinhdprlpvsgtgewdwkgiqpfannpkvynpksgyianw
    nnspaknypasdlfaflwgsadrvkeidnrieaydkltaddmwailqqtsrvdlnhrlft
    pfltqatqglpsndnsvklvsmlqqwdginqlssdgkhyihpgsaildiwlkemlkatlg
    qtvpapfdkwylasgyettqegptgslnistgakllyeslledkspisqsidlfsgqpqn
    dvirktlnttyqkmiekygdnpanwqtpataltfrennffgipqalpqenfhqneyhnrg
    tendlivfteegvsawdvvapgqsgfispqgkpsphyqdqlslyqqfgkkplwlnsedva
    pyiestetliier