Lineage for d1cp9.1 (1cp9 A:,B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548839Family d.153.1.2: Penicillin acylase, catalytic domain [56244] (3 proteins)
  6. 2548856Protein Penicillin acylase [56245] (2 species)
    also contains 2 all-alpha and a beta-barrel domains
    will be divided into domains in future release
  7. 2548882Species Providencia rettgeri [TaxId:587] [56247] (1 PDB entry)
  8. 2548883Domain d1cp9.1: 1cp9 A:,B: [41849]
    complexed with ca, so4; mutant

Details for d1cp9.1

PDB Entry: 1cp9 (more details), 2.5 Å

PDB Description: crystal structure of penicillin g acylase from the bro1 mutant strain of providencia rettgeri
PDB Compounds: (A:) Penicillin G amidase, (B:) Penicillin G amidase

SCOPe Domain Sequences for d1cp9.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cp9.1 d.153.1.2 (A:,B:) Penicillin acylase {Providencia rettgeri [TaxId: 587]}
estqikierdnygvphiyandtyslfygygyavaqdrlfqmemakrstqgtvsevfgkdy
isfdkeirnnywpdsihkqinqlpsqeqdilrgyadgmnawikqintkpddlmpkqfidy
dflpsqwtsfdvamimvgtlanrfsdmnseidnlalltalkdkygeqlgveffnqinwln
npnapttisseeftysdXsnvwlvgktkasgakaillngpqfgwfnpaytygiglhgagf
nivgntpfaypailfghnghvswgstagfgdgvdifaeqvspedpnsylhqgqwkkmlsr
qetlnvkgeqpitfeiyrtvhgnvvkrdktthtayskarawdgkeltslmawvkqgqaqn
wqqwldqaqnqaltinwyyadkdgnigyvhtghypdrqinhdprlpvsgtgewdwkgiqp
fannpkvynpksgyianwnnspaknypasdlfaflwgsadrvkeidnrieaydkltaddm
wailqqtsrvdlnhrlftpfltqatqglpsndnsvklvsmlqqwdginqlssdgkhyihp
gsaildiwlkemlkatlgqtvpapfdkwylasgyettqegptgslnistgakllyeslle
dkspisqsidlfsgqpqndvirktlnttyqkmiekygdnpanwqtpataltfrennffgi
pqalpqenfhqneyhnrgtendlivfteegvsawdvvapgqsgfispqgkpsphyqdqls
lyqqfgkkplwlnsedvapyiestetliier

SCOPe Domain Coordinates for d1cp9.1:

Click to download the PDB-style file with coordinates for d1cp9.1.
(The format of our PDB-style files is described here.)

Timeline for d1cp9.1: