PDB entry 1clw

View 1clw on RCSB PDB site
Description: tailspike protein from phage p22, v331a mutant
Class: Viral protein
Keywords: LATE PROTEIN, VIRUS/VIRAL PROTEIN, Viral protein
Deposited on 1999-05-04, released 1999-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tailspike protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Gene: 9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12528 (0-553)
      • engineered (218)
    Domains in SCOPe 2.07: d1clwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1clwA (A:)
    ysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvltieckak
    figdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqsktdgy
    qptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgchfckm
    vdannpsggkdgiitfenlsgdwgkgnyviggrtsygsassaqflrnnggferdggvigf
    tsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdmnpeldrpgdy
    pitqyplhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllthesvf
    tniaiidtntkdfqanqiyisgacrvnglrligirstdgqgltidapnstvsgitgmvdp
    srinvanlaeeglgniransfgydsaaiklrihklsktldsgalyshinggagsgsaytq
    ltaisgstpdavslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstslkalvk
    kpngelvrltlatl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1clwA (A:)
    ysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvltieckak
    figdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqsktdgy
    qptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgchfckm
    vdannpsggkdgiitfenlsgdwgkgnyviggrtsygsassaqflrnnggferdggvigf
    tsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdrpgdypitqyp
    lhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllthesvftniaii
    dtntkdfqanqiyisgacrvnglrligirsltidapnstvsgitgmvdpsrinvanlaee
    glgniransfgydsaaiklrihklsktldsgalyshinggagsgsaytqltaisgstpda
    vslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstslkalvkkpngelvrltl
    atl