Lineage for d1clwa_ (1clw A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069302Family b.80.1.6: P22 tailspike protein [51150] (1 protein)
    automatically mapped to Pfam PF09251
  6. 2069303Protein P22 tailspike protein [51151] (1 species)
  7. 2069304Species Salmonella phage P22 [TaxId:10754] [51152] (18 PDB entries)
  8. 2069317Domain d1clwa_: 1clw A: [28043]
    mutant

Details for d1clwa_

PDB Entry: 1clw (more details), 2 Å

PDB Description: tailspike protein from phage p22, v331a mutant
PDB Compounds: (A:) tailspike protein

SCOPe Domain Sequences for d1clwa_:

Sequence, based on SEQRES records: (download)

>d1clwa_ b.80.1.6 (A:) P22 tailspike protein {Salmonella phage P22 [TaxId: 10754]}
ysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvltieckak
figdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqsktdgy
qptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgchfckm
vdannpsggkdgiitfenlsgdwgkgnyviggrtsygsassaqflrnnggferdggvigf
tsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdmnpeldrpgdy
pitqyplhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllthesvf
tniaiidtntkdfqanqiyisgacrvnglrligirstdgqgltidapnstvsgitgmvdp
srinvanlaeeglgniransfgydsaaiklrihklsktldsgalyshinggagsgsaytq
ltaisgstpdavslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstslkalvk
kpngelvrltlatl

Sequence, based on observed residues (ATOM records): (download)

>d1clwa_ b.80.1.6 (A:) P22 tailspike protein {Salmonella phage P22 [TaxId: 10754]}
ysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvltieckak
figdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqsktdgy
qptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgchfckm
vdannpsggkdgiitfenlsgdwgkgnyviggrtsygsassaqflrnnggferdggvigf
tsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdrpgdypitqyp
lhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllthesvftniaii
dtntkdfqanqiyisgacrvnglrligirsltidapnstvsgitgmvdpsrinvanlaee
glgniransfgydsaaiklrihklsktldsgalyshinggagsgsaytqltaisgstpda
vslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstslkalvkkpngelvrltl
atl

SCOPe Domain Coordinates for d1clwa_:

Click to download the PDB-style file with coordinates for d1clwa_.
(The format of our PDB-style files is described here.)

Timeline for d1clwa_: