PDB entry 1cld

View 1cld on RCSB PDB site
Description: dna-binding protein
Deposited on 1995-06-06, released 1995-09-15
The last revision prior to the SCOP 1.63 freeze date was dated 1999-06-09, with a file datestamp of 1999-06-08.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1cld__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cld_ (-)
    qacdacrkkkwkcsktvptctnclkynldcvys