PDB entry 1cjx

View 1cjx on RCSB PDB site
Description: crystal structure of pseudomonas fluorescens hppd
Class: oxidoreductase
Keywords: Oxidoreductase, Dioxygenase, Iron
Deposited on 1999-04-20, released 2000-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.219
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80064
      • see remark 999 (354)
    Domains in SCOPe 2.07: d1cjxa1, d1cjxa2
  • Chain 'B':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80064
      • see remark 999 (354)
    Domains in SCOPe 2.07: d1cjxb1, d1cjxb2
  • Chain 'C':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80064
      • see remark 999 (354)
    Domains in SCOPe 2.07: d1cjxc1, d1cjxc2
  • Chain 'D':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80064
      • see remark 999 (354)
    Domains in SCOPe 2.07: d1cjxd1, d1cjxd2
  • Heterogens: FE2, EMC, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cjxA (A:)
    adlyenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnn
    epnsiasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgig
    gaplylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyek
    lfnfrearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqh
    vafltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssv
    egdkrlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjxA (A:)
    yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
    siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
    lylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyeklfn
    frearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqhvaf
    ltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssvegd
    krlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cjxB (B:)
    adlyenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnn
    epnsiasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgig
    gaplylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyek
    lfnfrearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqh
    vafltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssv
    egdkrlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjxB (B:)
    yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
    siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
    lylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyeklfn
    frearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqhvaf
    ltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssvegd
    krlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cjxC (C:)
    adlyenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnn
    epnsiasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgig
    gaplylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyek
    lfnfrearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqh
    vafltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssv
    egdkrlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjxC (C:)
    yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
    siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
    lylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyeklfn
    frearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqhvaf
    ltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssvegd
    krlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cjxD (D:)
    adlyenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnn
    epnsiasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgig
    gaplylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyek
    lfnfrearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqh
    vafltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssv
    egdkrlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cjxD (D:)
    yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
    siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
    lylidrfgegssiydidfvylegvernpvgaglkvidhlthnvyrgrmvywanfyeklfn
    frearyfdikgeytgltskamsapdgmiriplneesskgagqieeflmqfngegiqhvaf
    ltddlvktwdalkkigmrfmtappdtyyemlegrlpdhgepvdqlqargilldgssvegd
    krlllqifsetlmgpvffefiqrkgddgfgegnfkalfesierdqvrrgvlat