Lineage for d1cjxd1 (1cjx D:4-153)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942578Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2942596Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)
  8. 2942603Domain d1cjxd1: 1cjx D:4-153 [38522]
    complexed with act, emc, fe2

Details for d1cjxd1

PDB Entry: 1cjx (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd
PDB Compounds: (D:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d1cjxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjxd1 d.32.1.3 (D:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]}
yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
lylidrfgegssiydidfvylegvernpvg

SCOPe Domain Coordinates for d1cjxd1:

Click to download the PDB-style file with coordinates for d1cjxd1.
(The format of our PDB-style files is described here.)

Timeline for d1cjxd1: