PDB entry 1ciz

View 1ciz on RCSB PDB site
Description: x-ray structure of human stromelysin catalytic domain complexes with non-peptide inhibitors: implication for inhibitor selectivity
Deposited on 1999-04-06, released 1999-09-01
The last revision prior to the SCOP 1.61 freeze date was dated 1999-11-03, with a file datestamp of 1999-11-02.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.209
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1ciza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cizA (A:)
  frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
  misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
  ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp