PDB entry 1cie

View 1cie on RCSB PDB site
Description: structural and functional effects of multiple mutations at distal sites in cytochrome c
Class: electron transport(heme protein)
Keywords: electron transport(heme protein)
Deposited on 1994-09-26, released 1995-01-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • conflict (56)
      • conflict (86)
      • conflict (106)
    Domains in SCOPe 2.02: d1ciea_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cieA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
    nvlwdennmseyltnpkkyipgtkmasgglkkekdrndlitylkkaae