PDB entry 1chq

View 1chq on RCSB PDB site
Description: surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants
Class: toxin
Keywords: toxin
Deposited on 1995-02-15, released 1996-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (34)
  Domains in SCOPe 2.06: d1chqd_
• Chain 'E':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (34)
  Domains in SCOPe 2.06: d1chqe_
• Chain 'F':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (34)
  Domains in SCOPe 2.06: d1chqf_
• Chain 'G':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (34)
  Domains in SCOPe 2.06: d1chqg_
• Chain 'H':
  Compound: cholera toxin b pentamer
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (34)
  Domains in SCOPe 2.06: d1chqh_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chqD (D:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkdemaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chqE (E:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkdemaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chqF (F:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkdemaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chqG (G:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkdemaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1chqH (H:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkdemaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman