PDB entry 1cdt

View 1cdt on RCSB PDB site
Description: cardiotoxin v4/II from naja mossambica mossambica: the refined crystal structure
Class: cytotoxin
Keywords: cytotoxin
Deposited on 1990-05-17, released 1991-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cardiotoxin vii4
  Species: Naja mossambica [TaxId:8644]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01452 (0-59)
  Domains in SCOPe 2.08: d1cdta_
• Chain 'B':
  Compound: cardiotoxin vii4
  Species: Naja mossambica [TaxId:8644]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01452 (0-59)
  Domains in SCOPe 2.08: d1cdtb_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cdtA (A:)
  lkcnklipiayktcpegknlcykmmlaskkmvpvkrgcinvcpknsalvkyvccstdrcn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cdtB (B:)
  lkcnklipiayktcpegknlcykmmlaskkmvpvkrgcinvcpknsalvkyvccstdrcn